Protein Info for ABIE41_RS13235 in Bosea sp. OAE506

Annotation: TIGR01620 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 55 to 74 (20 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 252 to 268 (17 residues), see Phobius details amino acids 294 to 299 (6 residues), see Phobius details TIGR01620: TIGR01620 family protein" amino acids 46 to 325 (280 residues), 222.1 bits, see alignment E=4.5e-70 PF05128: DUF697" amino acids 173 to 324 (152 residues), 139.8 bits, see alignment E=3.6e-45

Best Hits

Swiss-Prot: 46% identical to Y7254_BRADU: UPF0283 membrane protein blr7254 (blr7254) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K08990, putative membrane protein (inferred from 50% identity to met:M446_6217)

Predicted SEED Role

"GTP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABIE41_RS13235 TIGR01620 family protein (Bosea sp. OAE506)
MSKAPRAIRLDPAGPEGGLDPAVGRGDVAVLPESEPIDVVEPAAVAPVKRRWSWGGLFVA
GLSGFLALAFGVWAEQTIAWLMSQSPVLGYAALACAALAALALAVILGRVIRDILRERKV
EALRLRATAALADGSVDEAKAVAAELTALYGTRAETTKGRAQLADSLPQLFAARDVLTVA
ERSLMVPLDALAQAQIAQAARRVSLVTAVSPRALIDIVFVLVACARLLRTIAGIYAGRPG
TLGLLRLARQVLGHLVVTGGIAAGDAVIQQVVGQGLAARLSAKLGEGVLNGLLTARIGLA
ALAVCRPLPFVEAAPPTLGDVAGDLGSWGGSKDSGA