Protein Info for ABIE41_RS13180 in Bosea sp. OAE506

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 54 (18 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00892: EamA" amino acids 5 to 138 (134 residues), 63.2 bits, see alignment E=1.5e-21 amino acids 157 to 286 (130 residues), 42.7 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: None (inferred from 53% identity to rsk:RSKD131_2378)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>ABIE41_RS13180 DMT family transporter (Bosea sp. OAE506)
MSPLLGISLKLLSALAFTLMSAGIKHMSTRYPTGELVFFRSFFALIPLLIWLAWRSELPG
ALKTRNLRGHLKRGVIGSTGMFCGFAALQFLPLSDAVALGYAAPLGVVVLAALVLKERVR
IYRWSAVTIGFVGVLIMLSPHLSAGTLSQGLKGGPALGAALGLAGAFCSAFASIEVRLLT
KTEPTGAIVFYFMLLTSALGLITLAFGWRMPDLTEAAMLVAIGILGGFGQILLVQAYRFG
DASLIAPFEYSTMIWAVLIGWFVFGEWPVSTILIGAAIVIASGICVILREQRLGLLKREQ
REISSTRPT