Protein Info for ABIE41_RS12620 in Bosea sp. OAE506

Annotation: cell division protein FtsQ/DivIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details PF08478: POTRA_1" amino acids 82 to 149 (68 residues), 51.1 bits, see alignment E=1.4e-17 PF03799: FtsQ_DivIB_C" amino acids 153 to 266 (114 residues), 69.7 bits, see alignment E=4e-23

Best Hits

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 54% identity to met:M446_6699)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>ABIE41_RS12620 cell division protein FtsQ/DivIB (Bosea sp. OAE506)
MPAPGPQLLVGERTGRWLRRSRRSAVAVPLAQRLPRRLGTWLALSFLSLSLGAGTVLGGH
VETLRANYGEPHHMLARLVGFGIDRVTISGIAELSEVEVLVAAGIDSKTSLAFFDADQAR
RRLEAAPLIREATIRKLYPGEVAITLVEREPFALWQVKGELFVIAADGTVIDKMDDGRFA
HLPLVVGPEANNRAREYLALRGQAGPLAPQIRAATLVAGRRWNLKLENGMDVRLPEVDPG
AAVKRLAALQADYRIFDKDLLAIDLRQPDRVVMRLTEEGAAARAEQLKSKTKKKGGEA