Protein Info for ABIE41_RS12610 in Bosea sp. OAE506

Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 10 to 456 (447 residues), 537.4 bits, E=1.6e-165
• PF01225: Mur_ligase
  • amino acids 10 to 106 (97 residues), 114.6 bits, E=3.4e-37
• PF08245: Mur_ligase_M
  • amino acids 112 to 298 (187 residues), 98.8 bits, E=6.3e-32
• PF02875: Mur_ligase_C
  • amino acids 318 to 402 (85 residues), 51.5 bits, E=1.6e-17

Best Hits

Swiss-Prot: 81% identical to MURC_METNO: UDP-N-acetylmuramate--L-alanine ligase (murC) from Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 81% identity to mno:Mnod_7442)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Protein Sequence (473 amino acids)

>ABIE41_RS12610 UDP-N-acetylmuramate--L-alanine ligase (Bosea sp. OAE506)
MKLPPKLGPIHFVGIGGIGMSGIAEVLHNLGYKVQGSDASDGANVKRLAEKGITTFVGHK
AENLGEAEVVVVSTAIKRDNPELVAAREKRLPVVRRAEMLAELMRLKSCIAIAGTHGKTT
TTSLVATLLEKGGLDPTVINGGIINAYGTNARMGESDWMVVEADESDGTFLKLPADVAIV
TNIDPEHLDHFGTFDAIKAAFRSFVENLPFYGFAVMCIDHPTVQGLVGQIEDRRVVTYGE
NPQADFRLIDIDLSGGQAKFTLLIRDRKRGRDEVVRDLIMPMPGHHNALNATAAIAVAYD
LGIPVERIRAALAGFGGVKRRFTKTGEWNGALIFDDYGHHPVEIAAVLKAARASTKGKVI
AIVQPHRYTRLASLFDDFAACFNDADTVIVADTYAAGEAPIAGADRDSLVSGIKARGHRH
ALPLDGSDKLAGMVAELAGPGDYVVLLGAGNITQWAYALPGELAALSPPKPAA