Protein Info for ABIE41_RS12600 in Bosea sp. OAE506

Annotation: putative peptidoglycan glycosyltransferase FtsW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 209 (32 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 305 to 328 (24 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details PF01098: FTSW_RODA_SPOVE" amino acids 23 to 365 (343 residues), 257.8 bits, see alignment E=7.9e-81

Best Hits

KEGG orthology group: K03588, cell division protein FtsW (inferred from 66% identity to bid:Bind_0691)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>ABIE41_RS12600 putative peptidoglycan glycosyltransferase FtsW (Bosea sp. OAE506)
MVSRAEPSLSGRWWWSIDRVILSALVALMVSGVVLLMAGGPPVAERLGLSTFHFVNRQAA
YLTVALTIFVGVSFLTPRQVRRLALLLFTVSLAMVVATLYLGVEVKGARRWLTLGPIGSV
QPSEFLKPAFVVLAAWAFAEGTRRPDLPGTWIAFLLLPATIAPLVLQPDFGQTMLVTLVW
AGLFFVAGLHWFWVLGLGGAGAVGILIAYQLVPHVRARIERFMDKGSGDTFQIDTALESF
AQGGWLGKGPGEGTVKRILPDAHTDFIFAVTAEEFGIVVCILLVMLFALIVLRALFVAQK
AEDPFIRLAVTGLALLFGIQAAINMMVNLHMMPAKGMTLPFISYGGSSLISLAIGTGFLL
ALTRKRPRAVDFGSYRR