Protein Info for ABIE41_RS12590 in Bosea sp. OAE506

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 12 to 465 (454 residues), 342.5 bits, see alignment E=2.1e-106 PF08245: Mur_ligase_M" amino acids 119 to 305 (187 residues), 90.3 bits, see alignment E=1.7e-29 PF02875: Mur_ligase_C" amino acids 326 to 372 (47 residues), 32.6 bits, see alignment 8e-12

Best Hits

Swiss-Prot: 59% identical to MURD_CHESB: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 59% identity to mes:Meso_2009)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>ABIE41_RS12590 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Bosea sp. OAE506)
MTPVTCFAGRRVALFGLGGSGLATARALIAGGAQVEAFDDNPASRDRAAGEGIAVVDLAT
ADWSAFDSFILAPGVPLTHPVPHWTVAKAKAAGVEIIGDVELFFRQRMATEPAAPVVCIT
GTNGKSTTTALVAHVLRQAGRDVQMGGNIGTAVLALEPPSASRVHVIECSSYQIDLAPSL
APSVGIQMNLTPDHLDRHGTFEAYGAIKERLVSAADVAVIGVDDEPSKQMARRRAASGRK
LVKISGEQPLDDGVFAGVTANAGTLETRIVQVLDGKPRIVANLAGIGSLRGSHNAQNAAA
AFAACFALGLTAEQIAAGLASYPGLAHRMEEIGRIGRVVFINDSKATNADSTEKALTSFR
DIFWILGGKAKEGGIESLRRYFPNIARAYLIGAASDLFAATFDDDRRVAYERSGTLDVAL
ANAARDALAHPGRGDIAVLLSPACASFDQFPNFEVRGDAFRALVKALPGFQPPGNV