Protein Info for ABIE41_RS12585 in Bosea sp. OAE506

Annotation: phospho-N-acetylmuramoyl-pentapeptide- transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 23 to 48 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details TIGR00445: phospho-N-acetylmuramoyl-pentapeptide-transferase" amino acids 38 to 360 (323 residues), 400.8 bits, see alignment E=2.7e-124 PF10555: MraY_sig1" amino acids 68 to 80 (13 residues), 24.1 bits, see alignment (E = 1.8e-09) PF00953: Glycos_transf_4" amino acids 99 to 283 (185 residues), 110.7 bits, see alignment E=7.3e-36

Best Hits

Swiss-Prot: 74% identical to MRAY_XANP2: Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K01000, phospho-N-acetylmuramoyl-pentapeptide-transferase [EC: 2.7.8.13] (inferred from 74% identity to xau:Xaut_1847)

MetaCyc: 51% identical to phospho-N-acetylmuramoyl-pentapeptide-transferase (Escherichia coli K-12 substr. MG1655)
Phospho-N-acetylmuramoyl-pentapeptide-transferase. [EC: 2.7.8.13]

Predicted SEED Role

"Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)" in subsystem Peptidoglycan Biosynthesis (EC 2.7.8.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>ABIE41_RS12585 phospho-N-acetylmuramoyl-pentapeptide- transferase (Bosea sp. OAE506)
MLVWLADFSGTFPVLNVFRYITFRAGGATATALLVVFFFGPAAISWLRIKQGKGQPIRTD
GPQTHLAKRGTPTMGGLMILGGLLVATLLWGNLRNPYVWIVLGVTVSYGAIGFYDDYLKV
TKQSHKGFSGKARLALEMAIALFACWGVMQLGPPAIASGFAMPFLKELIIPLGIFFPLVT
AFVVVGAGNAVNLTDGLDGLAIVPVMIAAATFGFISYLAGNAIFANYLQIHHVPGAGELA
VICGAMIGAGIGFLWFNAPPAQIFMGDTGSLGLGGLLGVVAVATKHEIVLAIVGGLFVIE
ALSVIIQVFVYKRTGKRVFLMAPIHHHFEKLGWTEPQVVIRFWIISVVLALIGLSTLKLR