Protein Info for ABIE41_RS12545 in Bosea sp. OAE506

Annotation: organic hydroperoxide resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 4 to 139 (136 residues), 176.5 bits, see alignment E=1.6e-56 PF02566: OsmC" amino acids 39 to 138 (100 residues), 60.6 bits, see alignment E=8.4e-21

Best Hits

Swiss-Prot: 56% identical to OHR_XANCH: Organic hydroperoxide resistance protein (ohr) from Xanthomonas campestris pv. phaseoli

KEGG orthology group: None (inferred from 70% identity to oan:Oant_3292)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>ABIE41_RS12545 organic hydroperoxide resistance protein (Bosea sp. OAE506)
MKVLYTAHGSATGGREGKAATDSGNVTVVLNTPKELGGGGGEGTNPEQLFSMGYSACFLG
ALKFVAGKEKVKIPDDAKVSADVGIGPRDDGAGFGLAVTLTVSVPGVDKAVVEDLVQKAH
VVCPYSHATKGNIEVDLKVA