Protein Info for ABIE41_RS12240 in Bosea sp. OAE506

Annotation: regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 153 to 169 (17 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 334 to 378 (45 residues), see Phobius details amino acids 435 to 458 (24 residues), see Phobius details amino acids 463 to 482 (20 residues), see Phobius details amino acids 493 to 512 (20 residues), see Phobius details

Best Hits

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 79% identity to sno:Snov_2438)

Predicted SEED Role

"FIG00442423: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>ABIE41_RS12240 regulator (Bosea sp. OAE506)
MATTTASATTTSPKLWTPGDWNALFGFGTNILVNLLVLTGLLQFVLKMPTELIYGRILPA
LGLMMALSTGYYAYLAWKLAKETGRDDVCALPSGISVPHMFVVTFVIMLPIATMTGDPVK
GWEAGLVWVFFQSFILMIGGFIAPYIRRITPRAALLGTLAGVSIAFISMRPALEIFLTPA
IGLVCLAIILVSWFGGIRYPRGIPAGLVAIAFGLVIAWGSSLVGLDVGGLSLAKLGAAFS
NFGFSLPVPAFDHVFSGFTYLGIILVTAIPFGIYDLVEAMDNVESAEAAGDHYPTTRVLT
ADGVVSLIGCLMGNPFINAVYIGHPGWKAMGGRIGYSAATGLIVIVLCWFGIVALLLALI
PIVAISPILLYIGMLIGAQAFQTTPTSHAPAIVLAVTPHLAAWAKVQIDGALGAAGTNAA
AVGIDKMANMGVLYHGLELMGGGAILSGLVLGAIAVFVIEKQFAQAAAFAAAGAVLTYFG
LMHGEAIGIGKGLGVTPSISLAYAMVAGFLWYCGKSLAAESGAKTMTTEPRANLEPAE