Protein Info for ABIE41_RS12055 in Bosea sp. OAE506

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 31 to 101 (71 residues), 65.7 bits, E=1.9e-22

Best Hits

Swiss-Prot: 50% identical to YCIA_SALTI: Acyl-CoA thioester hydrolase YciA (yciA) from Salmonella typhi

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 80% identity to mpo:Mpop_2507)

MetaCyc: 50% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

MetaCyc Pathways

• palmitoleate biosynthesis IV (fungi and animals) (1/2 steps found)
• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Protein Sequence (138 amino acids)

>ABIE41_RS12055 acyl-CoA thioesterase (Bosea sp. OAE506)
MTKEAGVAQDEAPRGNLTVRINAMPADTNANGDIFGGWVMSRMDAAGGIAGVDRAQGRVV
TIAVDAMTFIRPVKVGDVLSVYTEVESVGRTSMKIHVEAWARRFRTMIHEKVTDATFTFV
AIDEEGRPRPVPRSVETP