Protein Info for ABIE41_RS12040 in Bosea sp. OAE506

Annotation: type 1 glutamine amidotransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 7 to 175 (169 residues), 182 bits, E=7.9e-58
• PF18011: Catalase_C
  • amino acids 7 to 180 (174 residues), 33.6 bits, E=2.9e-12
• TIGR01382: intracellular protease, PfpI family
  • amino acids 9 to 176 (168 residues), 181.7 bits, E=4.1e-58

Best Hits

Swiss-Prot: 45% identical to DEGLY_PYRFU: Deglycase PfpI (pfpI) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 73% identity to rpb:RPB_4121)

MetaCyc: 43% identical to archaeal arginyl aminopeptidase monomer (Pyrococcus horikoshii OT3)
RXN-23973 [EC: 3.4.11.27]

Predicted SEED Role

"ThiJ/PfpI family protein"

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.-.- or 3.4.11.27

Protein Sequence (186 amino acids)

>ABIE41_RS12040 type 1 glutamine amidotransferase domain-containing protein (Bosea sp. OAE506)
MSDLSGKTILILATNGFEQSELDVPHAKLKEAGATVHIVAPEAGEITGWDQKDWGRAVKV
DKTLAEVSADAYDAIVLPGGQMNPDTLRGTPEALTLIKRFFEQGKVVAAVCHAPWLLIDT
GIAKGRRLTSYNTMKQDMINAGALWEDSEVVTDKGVVTSRKPDDLPAFVAKIIEEINEGR
HERRAA