Protein Info for ABIE41_RS12020 in Bosea sp. OAE506

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 60 (26 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01810: LysE" amino acids 10 to 200 (191 residues), 115.8 bits, see alignment E=9.2e-38

Best Hits

KEGG orthology group: None (inferred from 71% identity to rpd:RPD_2814)

Predicted SEED Role

"RhtB family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>ABIE41_RS12020 LysE family translocator (Bosea sp. OAE506)
MSPEFLLTSLIVVASPGTGAIYTIAAGLTRGSRASLLAAFACTLGIVPHLLAAMLGLAAL
LHASALAFAVVKYAGVAYLLFMAWQTLQEHGALSVETKADPRSAWRVLRDGVAINVLNPK
LSIFFVAFLPQFISAGEAAPLARMLELSGVFMAMTFVVFALYGLFAAAMRDKVVTRPAVM
AWLRRGFAAAFVALGAKLAVTER