Protein Info for ABIE41_RS11335 in Bosea sp. OAE506

Annotation: VUT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details PF02592: Vut_1" amino acids 95 to 172 (78 residues), 36.4 bits, see alignment E=3.4e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>ABIE41_RS11335 VUT family protein (Bosea sp. OAE506)
MTLDRQRRIEGLVALVLFALTIPAANWLIGNAGTVCVPNGPCLVPVWPGIKAPSGVLMIG
LALVLRDIVQRRLGTAAGLGAIAVGAAISGFLAPSAIVVASVAAFLLSELADFAVYTPLQ
KRRFVTAVIASGLVGLVVDSVVFLQLAFGSLDFLSGQIIGKAWMVLLALPLMHLLRRRDE
KLGLAPA