Protein Info for ABIE41_RS11245 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 252 to 277 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 62 to 279 (218 residues), 51 bits, see alignment E=7.8e-18

Best Hits

Swiss-Prot: 35% identical to POTB_HAEIN: Spermidine/putrescine transport system permease protein PotB (potB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 54% identity to xau:Xaut_0858)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>ABIE41_RS11245 ABC transporter permease (Bosea sp. OAE506)
MSARRPEGLTASLLIGPATMVVMLSLVLPLALLARYSLNKYDRRTFMIEAFTPENYLRFV
TDPFYTGVLWTTFSIAIVTTLLCLILGFPIAYKLARSQSRWKSIGVLLIILPLFIGSTVR
ALGWMGVLGRGGIVDALYGALGGSGISLLYTSFAVGIGILSINLPYMILTLQSVIEGIDA
RLEEAADSLGADPTRRFWHVVLPLALPGIGTGGILVFILAMNAYATPFLLGGARFQMMAP
MLYREFAVNNNWPFAAAIAFILMLTTLSLTAVSGLLVQRRYKAQ