Protein Info for ABIE41_RS11105 in Bosea sp. OAE506

Annotation: ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 PF00005: ABC_tran" amino acids 23 to 147 (125 residues), 72 bits, see alignment E=4.1e-23 amino acids 297 to 432 (136 residues), 82.3 bits, see alignment E=2.8e-26 PF16326: ABC_tran_CTD" amino acids 530 to 597 (68 residues), 57.8 bits, see alignment E=5.4e-19

Best Hits

KEGG orthology group: None (inferred from 68% identity to xau:Xaut_2599)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>ABIE41_RS11105 ATP-binding cassette domain-containing protein (Bosea sp. OAE506)
MAPLLHLRDVALTFGGQPLLEAAEIAVSAGERVCLVGRNGSGKSTLLKIAAGLVDPDKAE
RFVQPGCTVRYLPQEPDFTGYKTSLAYVEAGLGPGDDAYRAQYLIDELGLTGEEDPATMS
GGESRRAALARVLAPEPDILLLDEPTNHLDLPVIEWLEQELKSLRSAMVLISHDRRFLTN
LSRATIWLDRGLTRRMDRGFGEFEAWRDEVLAQEELDRHKLDRKIAREEDWLRYGVSARR
TRNQRRLGELHGLREQRRTARFAVGSVKLEASEAQTSGKLVIEAVNVSKAYGSNVVIKDL
SLRVARGDRIGIVGPNGAGKTTLINLLTGQLAPDSGTVKLGVSLEMVTLDQRRESLDPAT
PLGDALTGGGSDQVMVGDTPRHVIAYMKDFLFQPLQRRTPVGALSGGERGRLMLARALAK
PSNMLVLDEPTNDLDLETLDLLQELLADYKGTVLLVSHDRDFIDRVVSATLICDGDGVWT
EFAGGYTDMLAQRGRGVGAKVRVASKAGVTAAEPVVAAPSAPAAPTSKRKLSFNEKHALE
TLPKKIAVLQAETTKLNQALAGDLYTRDPKLFAKATTRLEEVTREIAGLEERWLELEMLR
EEIGA