Protein Info for ABIE41_RS10915 in Bosea sp. OAE506

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 285 to 316 (32 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 13 to 693 (681 residues), 898.9 bits, see alignment E=1e-274 PF00771: FHIPEP" amino acids 24 to 685 (662 residues), 855.7 bits, see alignment E=1.3e-261

Best Hits

Swiss-Prot: 60% identical to FLHA_CAUVC: Flagellar biosynthesis protein FlhA (flhA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 76% identity to met:M446_3956)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (693 amino acids)

>ABIE41_RS10915 flagellar biosynthesis protein FlhA (Bosea sp. OAE506)
MSRGGLGKLLNRPDLFLAIGVMGILVVLIFPLPSILLDMLLALSIILSVLVLMTALFIEE
PLEFSAFPTVLLIVTMFRLALNLASTRLILAHGHEGTSAAGHVIEAFANFVMGGNFVIGV
IVFTILIIVNFVVITKGSGRIAEVAARFALDAMPGKQMAIDADLSAGLIDQEVAKVRRKA
LEDEANFFGSMDGASKFVRGDAIAGLLITFINVLGGIIIGVAQQGMTFGAAAHNYTQLTV
GDGLVSQIPALIVSTAAGLLVSKSGVRGAADKALGKQLSGYPKALGMSAAVMLLIAILPG
IPMLPFLTLALGSAWLARHFGQLAKARETEVADAAQAASPLQADGTPKEETLNDLLKLDE
LKIEIGYGLLPLVNSAGGQDRLTDQVRALRRQLAAELGFVMPAVRIVDNVQLEANHYYIK
IKEIDAGHGIVYAGQYMAMDPMGGSVNLPGHNVLEPTFGLPATWIDGALQDEAQLRGYTV
VDAATVISTHLTEVLKSHMPELLSHAEVQKLLRELPKDHSDLVKEIVPSQISTTGIQRVL
QLLLSERISIRDLATIIEGIAEAAGGMKNPRDIAEHVRMRLSRQICAQFSNGQGLLPIIT
LSPAWESVFAESIIGQGEDRHLAMQPSRLQEFVHQVRDKFEDAARMGEMPALVTSGMARP
FVRQIIERFRRETPVLSQAEIHPRVRLKTVGTV