Protein Info for ABIE41_RS10895 in Bosea sp. OAE506

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00158: Sigma54_activat" amino acids 120 to 285 (166 residues), 241.2 bits, see alignment E=1e-75 PF14532: Sigma54_activ_2" amino acids 125 to 290 (166 residues), 80.7 bits, see alignment E=2.5e-26 PF07728: AAA_5" amino acids 142 to 262 (121 residues), 35.1 bits, see alignment E=2.6e-12 PF02954: HTH_8" amino acids 396 to 436 (41 residues), 55.8 bits, see alignment 6.1e-19

Best Hits

Swiss-Prot: 62% identical to FLBD_CAUVC: Transcriptional regulatory protein FlbD (flbD) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 75% identity to met:M446_5122)

Predicted SEED Role

"Transcriptional regulatory protein flbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>ABIE41_RS10895 sigma-54 dependent transcriptional regulator (Bosea sp. OAE506)
MRLIIAGGLKGQLIAAAKIAIAHGANVTHTESLEQTLAVLRSKGADLLMVEVTLPVAQFV
AALEAERIRTPIVACGTSTDARAAVAAIQAGAREYVPLPPDPELIAAVLEAVAADQSSLI
WKDPAMERVVQLVGQIARSDAPVLVTGESGTGKEVIARHLHQKSLRKDKPFVAVNCAAIP
DNLLESELFGHEKGAFTGAIARRIGKFEEANGGTLLLDEISEMDVRLQAKLLRALQERMI
DRVGGTTPVKVDLRIIATSNRNLGDAVREGSFREDLFYRLNVVHLRLPALRERPGDILAL
ADHFARKYAELNGMPLRPIAPDARKLLLTNAWRGNVRELENTIHRAVLLARGNEIGTEAV
MTPEGETLGPASGRDSAARAAQTAEAMTRSLVGHTVADVERELILDTLDHCLGNRTHAAK
ILGISIRTLRNKLSEYTSAGITVAEPGQARVSAL