Protein Info for ABIE41_RS10105 in Bosea sp. OAE506

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 24 to 561 (538 residues), 695.2 bits, see alignment E=2.8e-213 PF00664: ABC_membrane" amino acids 29 to 284 (256 residues), 72.2 bits, see alignment E=5.9e-24 PF00005: ABC_tran" amino acids 354 to 499 (146 residues), 100.7 bits, see alignment E=1e-32

Best Hits

Swiss-Prot: 51% identical to PRSD_RHIME: Type I secretion system ATP-binding protein PrsD (prsD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 54% identity to mpo:Mpop_2861)

Predicted SEED Role

"Type I secretion system ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>ABIE41_RS10105 type I secretion system permease/ATPase (Bosea sp. OAE506)
MSNSFQDGARSPEVSRAFGACTRWFGGVAVFSALVNILYLTGSLYMLQVYDRVLTSRSVP
TLVALSLIVLAAFLLQGVLDGLRTRMLARIGARFDELLAPRVYQVVAELPLKGVRGSEVV
APVRDLDQVRGFLSGLGPTALFDTPFMPIFLIVIFQLHPWLGWLTVCGVVVIIGLTLLTE
RRSQPPARALAEVSVHRHNLVETTRRNAEVVGALGMRPAFLARYSAISERHVTETLKASD
VVSGLGAFAKVFRLILQSASLGLGAYLAIKGEISAGVIIAASILTSRALAPIETAVAHWK
GFVAARQSYRRLERSLALVPADEQRLPLPAPARHLVAKDLVVGPPGQPTPVLVGVSLRLT
AGDAIGVIGPTGSGKSTLARALVGVWPAHKGKVRLDGAALDQWGDQLGRHIGYLPQDVEL
FDGTVAENISRFAATPDPEAIIAAARAAAAHDLILELPKGYDSRIGEAGASLSGGQRQRV
ALARALYGDPFLVVLDEPNANLDNAGDEALNAAIRSVRARGGIAVVITHRPSGLAAVNLV
AVLKDGRIGTAGPRDEVLQSLAQPVSGPMARPARVVSA