Protein Info for ABIE41_RS10080 in Bosea sp. OAE506

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 49 to 67 (19 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details PF20398: DUF6691" amino acids 11 to 139 (129 residues), 158.1 bits, see alignment E=9.1e-51

Best Hits

Swiss-Prot: 64% identical to Y765_XYLFA: UPF0394 membrane protein XF_0765 (XF_0765) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K07112, (no description) (inferred from 65% identity to bmf:BAB2_0778)

Predicted SEED Role

"GENE II AND X PROTEINS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>ABIE41_RS10080 YeeE/YedE family protein (Bosea sp. OAE506)
MTALAFARFGAALFCGILFGLGLSVSGMIDPARVLGFLDLASGRWDPSLMFVLGGAVGVA
ALGVALQRRLGRPLLDTQFHMPPSERIDRRLVAGSLLFGAGWGLAGFCPGPAVTALSTGL
PPVLLFVLAMIAGMLLHDRVLARAAG