Protein Info for ABIE41_RS09980 in Bosea sp. OAE506

Annotation: magnesium protoporphyrin IX methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR02021: magnesium protoporphyrin O-methyltransferase" amino acids 10 to 230 (221 residues), 242.9 bits, see alignment E=1.3e-76 PF03602: Cons_hypoth95" amino acids 40 to 98 (59 residues), 30 bits, see alignment E=1.6e-10 PF13489: Methyltransf_23" amino acids 47 to 199 (153 residues), 41.7 bits, see alignment E=3.9e-14 PF05175: MTS" amino acids 51 to 132 (82 residues), 27.6 bits, see alignment E=8.4e-10 PF13847: Methyltransf_31" amino acids 62 to 141 (80 residues), 37 bits, see alignment E=1.1e-12 PF13649: Methyltransf_25" amino acids 65 to 153 (89 residues), 55.5 bits, see alignment E=3e-18 PF08241: Methyltransf_11" amino acids 66 to 149 (84 residues), 45.6 bits, see alignment E=3.6e-15 PF08242: Methyltransf_12" amino acids 66 to 153 (88 residues), 40 bits, see alignment E=2.1e-13 PF07109: Mg-por_mtran_C" amino acids 132 to 231 (100 residues), 102.1 bits, see alignment E=6.9e-33

Best Hits

Swiss-Prot: 52% identical to BCHM_RHOCA: Magnesium-protoporphyrin O-methyltransferase (bchM) from Rhodobacter capsulatus

KEGG orthology group: K03428, magnesium-protoporphyrin O-methyltransferase [EC: 2.1.1.11] (inferred from 67% identity to rce:RC1_2111)

Predicted SEED Role

"Mg-protoporphyrin O-methyltransferase (EC 2.1.1.11)" in subsystem Chlorophyll Biosynthesis (EC 2.1.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>ABIE41_RS09980 magnesium protoporphyrin IX methyltransferase (Bosea sp. OAE506)
MADANYIQRRGELQTYFDRTAVDAWARLTTDAPVSGIRATVRAGRDAMRNKLLAWLPHDI
RGARILDAGCGTGALAVECALRGAHVTAIDLSPTLVALAQDRSPRKLCGGSISFRTGDML
DPALGRFDHVVAMDSLIHYKAADIVGALSRLAERTAGSMLVTHAPRTPALTLMHWAGLAF
PRADRAPAIEPVSSDSLARAIAGERSLAPWRIGRSERVSSAFYKSQALELVAR