Protein Info for ABIE41_RS09795 in Bosea sp. OAE506

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 111 (96 residues), 85.7 bits, see alignment E=1.2e-28 PF00528: BPD_transp_1" amino acids 37 to 213 (177 residues), 72.1 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 35% identical to GLNP_BACSU: Probable glutamine ABC transporter permease protein GlnP (glnP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 66% identity to pol:Bpro_0692)

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>ABIE41_RS09795 amino acid ABC transporter permease (Bosea sp. OAE506)
MAYTLQYGQVTPYLGYLAGGAWLALQLAAIAFVIGWAIGLVCASVLEYGPRPLRWLVKAY
VVFFLNTPLLVQIFFLYFALPDWGIVLGSYQAVLLGMAINAGAYLTEIQRAGFRSIRKAE
IEAAETLGFSRIQIIRYVVLPHIGKVLFPPLSNQYIILTMTTSIAAIFGVEELTGRTYNI
NAQTFRSFEIFSIAALYYIALTLVASAALYAVGRYFFRIKGKVF