Protein Info for ABIE41_RS08935 in Bosea sp. OAE506

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 TIGR00631: excinuclease ABC subunit B" amino acids 141 to 791 (651 residues), 1000.8 bits, see alignment E=1.3e-305 PF04851: ResIII" amino acids 149 to 275 (127 residues), 47.1 bits, see alignment E=7.7e-16 PF00270: DEAD" amino acids 154 to 220 (67 residues), 28.5 bits, see alignment 3.7e-10 PF17757: UvrB_inter" amino acids 298 to 386 (89 residues), 103.1 bits, see alignment E=2.1e-33 PF00271: Helicase_C" amino acids 572 to 682 (111 residues), 69.3 bits, see alignment E=9.7e-23 PF12344: UvrB" amino acids 689 to 730 (42 residues), 75.9 bits, see alignment 5.3e-25 PF02151: UVR" amino acids 762 to 793 (32 residues), 33.3 bits, see alignment (E = 8.8e-12)

Best Hits

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 82% identity to bid:Bind_0291)

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>ABIE41_RS08935 excinuclease ABC subunit UvrB (Bosea sp. OAE506)
MSDTPAKPKPAKKPSSARTPNSKASRQELKPLEGYLADLLNPAINRGKAVPGGAAGFSDK
PQAGYEAKPSYATERPGGEERPKRKLSKKADAAFIGAEGAAAATATSLQTLLESGNPFIE
PGKAWVPHRPPRPDKSEGGIRFRMNSEYEPAGDQPAAIAELVEGIARQERDQVLLGVTGS
GKTFTMAQVIEKTQRPALILAPNKTLAAQLYGEFKSFFPDNAVEYFVSYYDYYQPEAYVP
RSDTFIEKESSINEQIDRMRHSATRSLIERDDVIIVASVSCIYGIGSVETYTAMTFGIKL
GERVEQRQLIADLVALQYKRTQHDFTRGSFRVRGDVIELFPAHYEDRAWRIGLFGDEVES
IAEFDPLTGQKTADLEFVKVYGNSHYTTPRPTLTQAVKSIKQELKARLDELNSMGRFLEA
QRLDQRCTFDIEMIEATGSCNGIENYSRYLTGRKPGEPPPTLFEYLPDNALVFTDESHVT
VPQIGGMYRGDFRRKATLAEYGFRLPSCMDNRPLRFEEWDAMRPQSVHVSATPGSWEMEQ
TGGVFTEQVIRPTGLIDPPVEIRPAKHQVADLLDEIKDVTAAGYRTLVTVLTKRMAEDLT
EYLHENGVRVRYMHSDIDTIERIEILRDLRLGAFDVLVGINLLREGLDIPECGFVAILDA
DKEGFLRSETSLIQTIGRAARNVDGKVILYADQVTGSMERALAETSRRREKQLAYNAEHG
ITPQTIKRAIGDILGSVYERDHVTVDAGLGTPAAGHNFKAALADLEKRMREAAADLEFET
AARLRDEIKRLQATELAISDDPLARQGDVEASAGKYKGERSYGSSANLPPTRARKPTDAD
MGPHNFGGGEGKPVSRALPKKPTLDEMGPRTEQRPKGAGERRGRRG