Protein Info for ABIE41_RS08865 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 77 to 106 (30 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 312 to 342 (31 residues), see Phobius details amino acids 355 to 381 (27 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF06808: DctM" amino acids 10 to 414 (405 residues), 418.9 bits, see alignment E=1.1e-129 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 420 (404 residues), 450.2 bits, see alignment E=3e-139

Best Hits

Swiss-Prot: 41% identical to DCTM_PSEAE: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 50% identity to smd:Smed_3834)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABIE41_RS08865 TRAP transporter large permease (Bosea sp. OAE506)
MLMVQILPVWFAALLIGVPLFVSMGLAAIAFAFLGGFPLGIVPQKIAQSANSFPLLAAPL
FILMGNIMNSAGITDRIFAFATACVGWLRGGLCHANILASVIFAGMSGSAVADAGGVGTL
EIKAMKDEGYDAETAAAITAASATIGPIIPPSLPMVIYGVSADVSIGGLFLAGVIPGLLM
AGALMAMVVHVAKKRDLPRHPFPGVAQLWVAYKEAHWALMTPVILFGGMMAGIFTPTEAA
AVATAYALVLGLFVYRSFDLDDLPELVVQTVETTGVVLALVMTAAALGWCLSISRIPQVV
GPMLVDLAGNPLIFLLIVNLLLLFVGCFMEALAAMLILIPILTPAAAQFGIDPIQFGLIF
VLNLMIGTITPPVGVVLFVTAKVANISFESMSRAIVPWLMPLLAVLVAITLWPPLTTWLP
NLVMGR