Protein Info for ABIE41_RS08835 in Bosea sp. OAE506

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 78 to 279 (202 residues), 76.5 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 35% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 66% identity to oan:Oant_0362)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>ABIE41_RS08835 sugar ABC transporter permease (Bosea sp. OAE506)
MSRRATGCSRRPAVLVVGTVIVFPWLFTLYMSGHDWKIGGGPEFVGLQNFAELFRDTRFI
ESMGHTLYFTVLAVVLPIVFGTAAALVFHREFPFRGLLRTVFVMPMMATPVAVALVWTMM
FHPQLGVLNYLLSLVGIGPQAWVYSPDTVIPTLILVEVWHWTPLVMLIVLGGLAGLPREP
YESALIDGANDWHMFRHITLPLVWPFIMVAIVIRTIDALKAFDTIFVITQGGPGTASETL
NIFLYLQAFQFYKIGYASAVVVIFFVIVIMLSLLLLYARQKSKWNA