Protein Info for ABIE41_RS08655 in Bosea sp. OAE506

Annotation: mucoidy inhibitor MuiA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02231: conserved hypothetical protein" amino acids 26 to 552 (527 residues), 385.3 bits, see alignment E=2.4e-119 PF13600: DUF4140" amino acids 30 to 128 (99 residues), 68.1 bits, see alignment E=7.6e-23 PF13598: DUF4139" amino acids 218 to 547 (330 residues), 173.8 bits, see alignment E=4.1e-55

Best Hits

Predicted SEED Role

"Aspartate ammonia-lyase (EC 4.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 4.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (572 amino acids)

>ABIE41_RS08655 mucoidy inhibitor MuiA family protein (Bosea sp. OAE506)
MMTRLAAALVLAPGFAGAAEIELATRIDRVTVYPDGAVVTRLGKAELMQGASQIVLRGLP
ATIDPASIRVEGRGSAGFSVGAVDVRLAPGEARPVLDTVIEGKLKTLREEKETLAGRIAA
IEAKRATIERFGQTGPDKLGPDGKALAVADWPAVFEAIGTALVKVHEELRGVRARAADVE
GEIAALERAKPQPGRPGAPRRDVAIAVEVPAPLAAEFSVSYRVTGANWTPQYEARLLTAG
AGGKPGIDLVRRAELRQRTGEDWSDVALTLSTTRSAGGTRAPDLTPVQVMFFEPPVLYEA
RRATAPAPMAAARAKAEADAQAEASQRAVAAPAPVAAEAQTATVEAGAYQASFQVPGRAT
IPQDGSSKTVLLSQAKAEPALTARIVPELEDKAYLEASFVHEEAAPLLPGMVALHRDGSY
IGRGRIGLVAPGDKVELGFGADDKLKVTRAPVRRRENEPNWLGQSRTDLREFRTVVKSLH
AQPVKVTVTERIPFSESSAITVESLPAQTTPPTEKQVGDKRGVSAWTFDLAPGAEKEIKV
AYRIKWPGDREVTYAPQPGPGPGPQPMPRPLN