Protein Info for ABIE41_RS08600 in Bosea sp. OAE506

Annotation: thioesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20791: Acyl-ACP_TE_C
  • amino acids 18 to 45 (28 residues), 22.9 bits, 1.2e-08
• PF13279: 4HBT_2
  • amino acids 22 to 139 (118 residues), 69.8 bits, E=4.4e-23
• PF03061: 4HBT
  • amino acids 29 to 111 (83 residues), 59.4 bits, E=5.5e-20

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 62% identity to vei:Veis_2066)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Protein Sequence (150 amino acids)

>ABIE41_RS08600 thioesterase family protein (Bosea sp. OAE506)
MSGRQERLERAAFGVFRPVPTRWHDNDVYGHVNNVVYYAWFDTAVNAWLVEHGFLDIAGS
ATVGLVVETTCTYFESVAFPETVELGLGVERLGTSSVTYRIGVFRQDSRLAAAQGRFTHV
YVDRATQRPVPIPADLRVALEALTSSGGSG