Protein Info for ABIE41_RS08570 in Bosea sp. OAE506

Annotation: glutamate synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01317: glutamate synthase, NADH/NADPH, small subunit
  • amino acids 3 to 473 (471 residues), 642.7 bits, E=2e-197
• PF14691: Fer4_20
  • amino acids 23 to 133 (111 residues), 87.7 bits, E=2.5e-28
• PF00070: Pyr_redox
  • amino acids 147 to 181 (35 residues), 22.8 bits, 5.3e-08
• PF07992: Pyr_redox_2
  • amino acids 147 to 455 (309 residues), 79.3 bits, E=1.8e-25
• PF00890: FAD_binding_2
  • amino acids 148 to 182 (35 residues), 20.6 bits, 1.1e-07
• PF13450: NAD_binding_8
  • amino acids 150 to 184 (35 residues), 36.6 bits, 2.3e-12
• PF01593: Amino_oxidase
  • amino acids 156 to 185 (30 residues), 25.7 bits, see alignment (E = 3.5e-09)

Best Hits

Swiss-Prot: 51% identical to GLTD_MYCTO: Glutamate synthase [NADPH] small chain (gltD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00266, glutamate synthase (NADPH/NADH) small chain [EC: 1.4.1.13 1.4.1.14] (inferred from 78% identity to azc:AZC_0461)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• ammonia assimilation cycle I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamate biosynthesis IV (1/1 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• superpathway of ammonia assimilation (plants) (2/3 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13, 1.4.1.14

Use Curated BLAST to search for 1.4.1.13 or 1.4.1.14

Protein Sequence (474 amino acids)

>ABIE41_RS08570 glutamate synthase subunit beta (Bosea sp. OAE506)
MGKVTGFLEFDRQEQKYQLAGDRIRHFREFTLPLEERDVKKQAARCMDCGIPFCHGPTGC
PVHNQIPDWNELVYSGGWEDALRNLHSTNNFPEFTGRICPAPCEEACTLNLENMPVTIKT
IEQAIADKGWQEGWIVPEPAAVRTGKKIAVVGSGPAGLAAAQQLARVGHEVHVYEREARA
GGLLRYGIPDFKMEKKHIDRRVKQMEAEGVTFHYNVNIGVTLPFRELVDGHDAVLMSGGA
ETPRDPGLPDTNLDGVHYAMPYLTQQNKRVGGEDVSGITPILAGGKHVVVVGGGDTASDC
VGTAFRQGALSVTQLDIRPMAPQIEDKLTVWPYWPTKFRTSSSQAEGAEREFQAATLGLE
GRNGKLTGVRCARVDEKRQPIPGTEFVLQADLCFLAIGFAGSLIEGMIAQSGAAVDKRAN
VVANDSDYRTSVDKVFVAGDMRRGQSLVVWAIREGRQAAHAIDKHLMGETILPV