Protein Info for ABIE41_RS07820 in Bosea sp. OAE506

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 155 to 162 (8 residues), see Phobius details amino acids 166 to 195 (30 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 314 to 345 (32 residues), see Phobius details amino acids 356 to 384 (29 residues), see Phobius details amino acids 397 to 421 (25 residues), see Phobius details PF06808: DctM" amino acids 8 to 417 (410 residues), 388.3 bits, see alignment E=2.1e-120 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 422 (406 residues), 436.2 bits, see alignment E=5.3e-135

Best Hits

KEGG orthology group: None (inferred from 75% identity to azc:AZC_3336)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>ABIE41_RS07820 TRAP transporter large permease (Bosea sp. OAE506)
MAITILFTSFAALLLMGVPVAFCLGLSSMATVLYIGIPPVVIFQQMSTGMNAFAMLAIPF
FIYSGDLMIRGGIADRLIQFASSLVGHLRGGLGQVNVITCTLFGGISGSAVADASAVGGI
MIPQMVKRGYAPDYAVNVTANAAIIALLIPPSHNMIIYSLAAGGTISIADLFTAGVLPGL
MLCLALMVAAWAVAVNRGYPADIFPGFLTVARLFIAATPGLLLIGIIFGGVRSGVFTATE
SSCVAVIYALLVTIFVYRGLDLKGFTHATLGAVRTTAMVLLIIGAASSFGWLMAFLEVPK
ATIALMQSISDNPLVILLMINVILLVLGTFMDMAPMIIICTPIFLPVVKAIGVDPVHFGV
ILILNAGIGLNTPPVGSVQFVACAIGKVSISESMKTIWPFYGASVAVLLLITYVPAFSLW
LPGVFR