Protein Info for ABIE41_RS07350 in Bosea sp. OAE506

Annotation: calcium-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF00353: HemolysinCabind" amino acids 39 to 70 (32 residues), 25.7 bits, see alignment (E = 4.6e-10) amino acids 76 to 101 (26 residues), 24.3 bits, see alignment (E = 1.3e-09) amino acids 111 to 144 (34 residues), 36 bits, see alignment 2.7e-13 amino acids 186 to 218 (33 residues), 27.6 bits, see alignment (E = 1.1e-10) amino acids 202 to 235 (34 residues), 29 bits, see alignment 4.1e-11 amino acids 266 to 297 (32 residues), 14.7 bits, see alignment (E = 1.3e-06) amino acids 272 to 305 (34 residues), 19.4 bits, see alignment 4.3e-08 amino acids 298 to 332 (35 residues), 25.5 bits, see alignment 5.1e-10

Best Hits

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>ABIE41_RS07350 calcium-binding protein (Bosea sp. OAE506)
MTQLNATTFVGVASRNEYFTFFDASYVDAGAGNDGVVGSFLSDYIMGGAGDDIIQGNTGN
DVIIGDFASDVNSSVGGNDFIDAGIGSDTVFGGGGDDFIFGSVPDGFNTTDPDDDYLDGG
AGNDVIWGGRGSDTIIGGDGDDTLFGSTRTFGGSVTLTVTLTHNGTTDAVESRNFIGFVP
ITGDDGAADSLDGGNGNDFLAGGSGNDTLRGGNDQDQLDGSAGADLLDGGQGFDFARYDG
SLLGVVVRLDSGVGLNGDAQGDSLIGIEGLIGSAQQDFLIGDAQSNALVGQSGDDWLFGQ
GGGDELRGGIGSDQLIGGTGADQLYGDTGNDQFWTLAADFQAGVWDVIYDFGEAADNFDY
LRFEGVSASQLIIGDNGGHAVITTSALNYSGGIIILNFSGVQTLDQLIFA