Protein Info for ABIE41_RS07320 in Bosea sp. OAE506

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 8 to 186 (179 residues), 146.8 bits, see alignment E=8.8e-47 PF13561: adh_short_C2" amino acids 15 to 246 (232 residues), 187 bits, see alignment E=6.4e-59

Best Hits

KEGG orthology group: None (inferred from 71% identity to met:M446_6011)

MetaCyc: 59% identical to 2-dehydro-3-deoxy-D-pentonate/2-dehydro-3-deoxy-L-fuconate 4-dehydrogenase (Herbaspirillum huttiense)
RXN-22641 [EC: 1.1.1.434]; 1.1.1.434 [EC: 1.1.1.434]

Predicted SEED Role

"2-keto-3-deoxy-L-fuconate dehydrogenase" in subsystem L-fucose utilization temp

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.434

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>ABIE41_RS07320 SDR family oxidoreductase (Bosea sp. OAE506)
MAGRLKGKVAVVTAAGQGIGRAIAEAFVAEGATVWATDKDVALLEGIPKAKKRKLDVLSN
KAVEAFAAKVGTIDILVNAAGYVHHGTVLDTDDKAWDFSFDLNVTSMHRTIKAFLPGMLE
KGAGSIVNIASGAGSVRGIPNRYAYGTTKAAVIGLTKAVAADFIKKGIRSNAICPGTIQS
PSLDQRIKDLATSTKTTEAAARQAFIDRQPMGRLGTAQEIAWLAVYLASDEASYTTGQIH
LADGGFAL