Protein Info for ABIE41_RS07180 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 69 to 94 (26 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 264 (183 residues), 36 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 54% identity to bge:BC1002_6166)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>ABIE41_RS07180 ABC transporter permease (Bosea sp. OAE506)
MSATTRPSLGRIALNGAAAVALLYILLPLIFVTWLAFFRQEIPSFPPEGYSLKWFSAAAN
NQPFINGFVLSLQVGVSATLIGLLLGVPASLALVRHRIVLGPAYNTLLLLPLVMPGIVLG
TATYVFQIETEIATGLPVMGSLGGLIAAHTLVVIPWVVRLVTASLVGFDRTIEEAAQNLG
AGPFTTFRRVTLPSIRPGIVAAGLFGFVTSFGNLEMSLFLVGPGRTTLPIAILQYLEWKI
DPTVAAASLIQIVLIAVAMIVTDRYVKLSRVV