Protein Info for ABIE41_RS06260 in Bosea sp. OAE506

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF04321: RmlD_sub_bind" amino acids 1 to 154 (154 residues), 48.1 bits, see alignment E=2.3e-16 PF01370: Epimerase" amino acids 4 to 229 (226 residues), 125.9 bits, see alignment E=4.4e-40 PF01073: 3Beta_HSD" amino acids 4 to 218 (215 residues), 46.2 bits, see alignment E=7.9e-16 PF16363: GDP_Man_Dehyd" amino acids 5 to 306 (302 residues), 90.4 bits, see alignment E=4e-29 PF07993: NAD_binding_4" amino acids 83 to 177 (95 residues), 28.1 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 71% identity to mci:Mesci_3345)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.2

Use Curated BLAST to search for 4.2.1.46 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>ABIE41_RS06260 NAD(P)-dependent oxidoreductase (Bosea sp. OAE506)
MKHIIIGGDGFVGSHLAADLAAMGEEVLVADIVKSRHPHYATVPFHRIDVTDAESVAGIP
LRQDDLVYNLSAKMLSPIVTRAERHDFFWPVNYHGTQNILSWMEKAGAHKLVHFTTDMIY
GHSVTVPQDETHPAKPLGEYGESKLATETLAQTYRDRGFQIPIFRPRLIIGPGRLGILVK
LFKLIDLNLPVPMIGSGKNPYQFISVFDCASACVAAWKADFPNSAYNLGSDDPPPVRKLL
GDLIAHAGSKSILLPTPAPLVKLTLNALDAINMPIMDPEQYMIADEICILDTSKAKRELG
WKPLHRDEDMLLAAYTEYRKAKDPQVQAQRSLAA