Protein Info for ABIE41_RS06250 in Bosea sp. OAE506

Annotation: sigma 54-interacting transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 PF00989: PAS" amino acids 139 to 252 (114 residues), 51.2 bits, see alignment E=4.8e-17 TIGR00229: PAS domain S-box protein" amino acids 140 to 262 (123 residues), 65.6 bits, see alignment E=2.3e-22 PF08448: PAS_4" amino acids 144 to 257 (114 residues), 50.4 bits, see alignment E=9.5e-17 PF13426: PAS_9" amino acids 147 to 254 (108 residues), 59.1 bits, see alignment E=1.8e-19 PF14532: Sigma54_activ_2" amino acids 297 to 458 (162 residues), 75.3 bits, see alignment E=2.3e-24 PF00158: Sigma54_activat" amino acids 297 to 462 (166 residues), 242.3 bits, see alignment E=9.1e-76 PF00004: AAA" amino acids 320 to 456 (137 residues), 26.1 bits, see alignment E=4.1e-09 PF07728: AAA_5" amino acids 320 to 439 (120 residues), 32.1 bits, see alignment E=4.5e-11

Best Hits

KEGG orthology group: None (inferred from 68% identity to azc:AZC_0759)

Predicted SEED Role

"Formate hydrogenlyase transcriptional activator" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (622 amino acids)

>ABIE41_RS06250 sigma 54-interacting transcriptional regulator (Bosea sp. OAE506)
MVDAALAVDVTTGQILAANEEARRLLTPSEREIVGASVLSVFPGQAAALTVFTEAVLHKG
RYWTRSLSPQRGDGEALHAECIGARLLTQPDPSILLTLYDLEARHRRDLDADAQEHVRAG
LTEWRRTERLFQEIERSNQLILRAAGEGIFGVNADGRTTFVNPAGEAMLGWETGELIGRD
MHACVHHHRPDGTHYPHEQCPIYAAFRDGAVHHVENEMFFRKDGSGFWVEYTSTPIRDRG
RLVGAVIIFRDISQRHEADERLRAALAEVDSLRERLQQENAYLQEEMRLERNHRGVVGRS
GAIQKILSQVELVARTDAAVLITGESGTGKELIASAIHEASERHVRPLIRVNCAAIPREL
FESEFFGHVKGAFTGALRDRIGRFELADGGTLFLDEVGEIPLELQGKLLRVLQEGQFERV
GEERTRHVNVRIIAATNKDLRREVREGRFREDLYFRLDVFPIVSVPLRERPEDIPLLALH
FLGGAQRKLKTEGLKLSEGDVARLRAYDWPGNVRELQNVIERAAILARNGRLFIALPEGG
RPPAAAPVPVAAGGAILTEAERRERDRVSILAALETARGRVSGPQGAAALLGLPATTLAS
RMKTLGIAPRSGTRPAPERAGG