Protein Info for ABIE41_RS06115 in Bosea sp. OAE506

Annotation: DUF167 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF02594: DUF167" amino acids 9 to 85 (77 residues), 75.6 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 59% identical to Y3939_METS4: UPF0235 protein M446_3939 (M446_3939) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K09131, hypothetical protein (inferred from 59% identity to met:M446_3939)

Predicted SEED Role

"COG1872"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>ABIE41_RS06115 DUF167 family protein (Bosea sp. OAE506)
MPWTASSDGLRLAVRLTPRGGRDAIDGVDILSDGKAVLKVRVRAAPSEGEANAALIALIA
RELGVSRAAVTLATGATSRVKLLAIAGDASALAARLEAACGPR