Protein Info for ABIE41_RS06070 in Bosea sp. OAE506

Annotation: calcium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 240 to 265 (26 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 304 to 328 (25 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 35 to 189 (155 residues), 57.6 bits, see alignment E=7.3e-20 amino acids 240 to 381 (142 residues), 23.9 bits, see alignment E=1.8e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>ABIE41_RS06070 calcium:proton antiporter (Bosea sp. OAE506)
MPVTILRLACAWATVAAFLLFGDALLGRLGEPLVAALVFAWLLGVIIWAAFGVVHEAEVL
AGRLGEPFGTLILTLSIVIIEVALISAVMLGAKGAPTLGRDTMFAVLMIVLNGVVGIGLL
VGGLRHFAQSYNMKGASSYLAVIIPLTVIPLVLPNFTTSTGEGTLTTLQAISFSVFTMAL
YGAFLVLQTGRHRSFFVEPTREQAPPVRSAPHGHTPDAEDIEIVEHDGHEDPGGATSTHV
VLLLANILPIVILAKSLAVVLDFGIVRLGAPVALGGILIAMVVFTPECIAALRAISANQL
QRAINLCLGAAASTLGLTVPAVLAIGLFTGQEVVLGLSGANMVILGMTLLLSTLTFTGTR
TTMLEGAVHLSVFFVFLVLVFSP