Protein Info for ABIE41_RS05600 in Bosea sp. OAE506

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 178 to 203 (26 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 58% identity to met:M446_2194)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABIE41_RS05600 ABC transporter permease (Bosea sp. OAE506)
MPESGQHDVEREERALPSNLRRDQPLVPIDNVAGRALMAVIAILTFLAALSAGAAVLAAR
ASEQWRGAVSNEMTIQIRPDSRRDIEADIARAVAMARAVEGVAAVQPIPRAESDKLLEPW
LGTGLDLVELPVPRLIVLKLRPSAVSDLAGFGAALRREVPTAILDDHRLWLRRLSTMAST
IILSGAAVVLLVMAAAALAVAFATRGAMAGSRDSVEVLHLVGADDDFIAREFQSRFVRLG
LRGGAIGGGAALVVIALLGILASRWSSAPEAEQLRAMFGAFEIGWGGYVAVVMVAVVVAA
ISGLVSRVTVRHHLHALAQGSA