Protein Info for ABIE41_RS05560 in Bosea sp. OAE506

Annotation: flagellar type III secretion system pore protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 39 to 68 (30 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 43 to 241 (199 residues), 290.6 bits, see alignment E=2.9e-91 PF00813: FliP" amino acids 43 to 237 (195 residues), 250.8 bits, see alignment E=5.3e-79

Best Hits

Swiss-Prot: 46% identical to FLIP_ECOLI: Flagellar biosynthetic protein FliP (fliP) from Escherichia coli (strain K12)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 71% identity to mrd:Mrad2831_1683)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABIE41_RS05560 flagellar type III secretion system pore protein FliP (Bosea sp. OAE506)
MLAVFSTLLAGTAAAQAQSFGLEGLLPPGGASASGRIVQIVAMLTVLSVAPGLLMMVTSF
SRFVIALSFLRSGLGLQSTPANLILVSLALFMTFFVMAPTFDKAWQDGVLPLVENRISES
EAYAKITAPFRDFMLAQTRPQDLRLFADLAPAGIRPQDPSQAVDLRVLIPSFMISELRRA
FEIGFLIALPFLVIDMIVATIVMSMGMMMLPPTVISLPFKVIFFVLIDGWNLLIGGLVRS
YS