Protein Info for ABIE41_RS05550 in Bosea sp. OAE506

Annotation: flagellar basal body L-ring protein FlgH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02107: FlgH
  • amino acids 58 to 233 (176 residues), 185.9 bits, E=2.5e-59

Best Hits

Swiss-Prot: 49% identical to FLGH_AZOC5: Flagellar L-ring protein (flgH) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 49% identity to azc:AZC_0630)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Protein Sequence (234 amino acids)

>ABIE41_RS05550 flagellar basal body L-ring protein FlgH (Bosea sp. OAE506)
MKPFLLVACAVTLAGCGTDMAELNREPTLSRVGSGLAVQRDAIPLGTPAGRGVDVAFNSI
YTRQSEDLFRDTRAMKTGDVVTVKISINDKAKLDNKSDRSRNSAAKYGLGFLANFNGASG
DASASANASSDTSSRGRGLTDRSEEVEMSVAAVVTEILPNGNLVINGSQEVRVNYDMRVL
NVTGIVRPRDITGNNVVSYEKIAEARISYGGRGRGMEVQQPAWGQQLVDKVTPF