Protein Info for ABIE41_RS05485 in Bosea sp. OAE506

Annotation: flagellar biosynthesis repressor FlbT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF07378: FlbT" amino acids 1 to 124 (124 residues), 129.2 bits, see alignment E=4.8e-42

Best Hits

Swiss-Prot: 52% identical to FLBT_RHILO: Probable flagellum biosynthesis repressor protein FlbT (flbT) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K06601, flagellar protein FlbT (inferred from 52% identity to mlo:mlr2941)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>ABIE41_RS05485 flagellar biosynthesis repressor FlbT (Bosea sp. OAE506)
MNLSLRANEKIYINGAILRFDRKVSLELMNDATFLLETHVIQPDETTTPLRQLYFVVQTM
LIDPKNAGAARLLFDRMLMTTACIFEDADVLLGLQAVDRLIVEERHFEALKQLRALYPAE
AAILASSGQARGSSLTATVRVASAAPRRCEAQLA