Protein Info for ABIE41_RS05250 in Bosea sp. OAE506

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 174 to 341 (168 residues), 68.7 bits, see alignment E=2.7e-23

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 80% identity to bra:BRADO4394)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>ABIE41_RS05250 carbohydrate ABC transporter permease (Bosea sp. OAE506)
MSLVTKLATARRKPGRWHWTDVAAYAYLALGVVLMFGPVLWLALSSFKTQAGLLEFPPSL
LPMSQQEVVVPGHPQPLPLFSVTMPDGSTRVLAQVRRIGIQAQMVDPANPAEVIRVPIDK
RTPVRGFKLATENYTEPLERFAFTRFLWNSVFVTVVATIITLIINSMAAYALSIYEFRGK
NTVMLMVIGTLMIPITIILVPVYLVITELGLVNSLWAVILPGAATPTGVFLLRQYMLTLP
RDLIEAARMDKASEWQIYWRIVMPLAMPALAVLAIFSVMWRWNEFLWPLAVLTKTESYTL
QIGLNAFQGELQTQWHYLLAMTVVTLLPVALVFVFLQRFITTGIANTGMK