Protein Info for ABIE41_RS05170 in Bosea sp. OAE506

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00005: ABC_tran" amino acids 20 to 167 (148 residues), 106.3 bits, see alignment E=2.2e-34 PF13304: AAA_21" amino acids 133 to 199 (67 residues), 37.2 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 43% identical to Y1272_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1272 (HI_1272) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 55% identity to mno:Mnod_2736)

MetaCyc: 36% identical to ferric citrate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABIE41_RS05170 ABC transporter ATP-binding protein (Bosea sp. OAE506)
MSLAASDLAYGYRERVIGRDIALSLSRGEVLALLGPNGSGKTTLLKTLLGLLPARGGTLL
LDDRPLSALSPPERARAIGYVPQAHAGTFAFTVEAVVLMGRSAHAGLFAAPSPRDHAVAA
AMLERLGIARLAQRPYTEISGGERQLVLIARALAQEPAYVVLDEPTASLDFGNQGRVMQE
IRRLAAEGLGVLFTTHDPNQALRHADRVMMIRDGQAIASGAAADLLTPGRLQQLYGVPIE
TVRDGDGRIAFLPG