Protein Info for ABIE41_RS05025 in Bosea sp. OAE506

Annotation: aldolase/citrate lyase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 24 to 246 (223 residues), 91.9 bits, E=1.8e-30

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 57% identity to mno:Mnod_1844)

Predicted SEED Role

"2-dehydro-3-deoxyglucarate aldolase (EC 4.1.2.20)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism (EC 4.1.2.20)

MetaCyc Pathways

• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (17/31 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.- or 4.1.2.20

Protein Sequence (259 amino acids)

>ABIE41_RS05025 aldolase/citrate lyase family protein (Bosea sp. OAE506)
MASQTVLSSLADRLARGDSLVSAWCGLQDPAIAGLLAKEGFDAVTLDMQHGPITLGEVIR
AIPLINAAGKPALARIAVGEFQNVSRLFDAGVSGVIAPMINTMEDARAFAAYSKYPPMGE
RSWGSYGGLGASGLDQNGYLREANRFSLSFAMIETREAMAILDDILALEGIDAVFVGPSD
LSIALSGGKEVNALSSEVDEAIRHIVARASAAGKPVAIYAQSAERAKAFLDMGAKLVTVM
SDTAFLRGAAQSALTVLGR