Protein Info for ABIE41_RS04880 in Bosea sp. OAE506

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 19 to 385 (367 residues), 366.1 bits, see alignment E=8.5e-114 PF21016: RlmN_N" amino acids 22 to 81 (60 residues), 43.4 bits, see alignment E=2.3e-15 PF04055: Radical_SAM" amino acids 196 to 314 (119 residues), 35.1 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 75% identical to RLMN_METS4: Dual-specificity RNA methyltransferase RlmN (rlmN) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 75% identity to met:M446_4556)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ABIE41_RS04880 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Bosea sp. OAE506)
MTVTVLEPAAPAAEPVLQRPSLVGRTRAGLAEALAEIGIPEKERRMRVGQLWNWIYHYGV
RDFAEMTTIGKGLRGALAERFTLDLPEVTAEQISTDGTRKWLMRMAPTGPRDRGAEIECV
YIPEVDRGTLCVSSQVGCTLTCTFCHTGTQRLVRNLTTEEIVAQLMVARDRLGDFPNRSA
PGGAFVPKDGGRFVSNIVFMGMGEPLYNFDSVRDAIDVISDNEGLSLGRRRITVSTSGVV
PQIGPLGSEMGTMLAISLHAVRDDLRNELVPLNKKYPIADLLEACRTYPGVSNAKRITFE
YVMLKGVNDSDAEARDLVRLLKGIPAKINLIPFNPWPGTKYECSDWDRIERFSEIVFRAG
YASPVRTPRGRDILAACGQLKSETEKLSARARLMLDQEDAAAATAG