Protein Info for ABIE41_RS04755 in Bosea sp. OAE506

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 358 to 375 (18 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 38 to 488 (451 residues), 423.9 bits, see alignment E=3.2e-131 PF00909: Ammonium_transp" amino acids 40 to 488 (449 residues), 371.1 bits, see alignment E=3.1e-115

Best Hits

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 78% identity to mno:Mnod_1817)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>ABIE41_RS04755 ammonium transporter (Bosea sp. OAE506)
MHFKTISRVGLVALALAAAGGALAQTPAAPAPVPNKGDVAFMMSSTVLVFLMTIPGLALF
YGGLVRSKNMLSVLTQVFAIVSIVALMWVIFGYSLAFTNGGGLNDYVGGFSKAFLRGVDA
TTTVATFSNGVVIPEYVYLAFQMTFACITPALIVGAFAERMKFSALLLFTVLWVTFIYFP
MAHMVWYWGGPDAVGNAAKALAEAGADGKAAAQAALDAVNADAGMLFKWGALDFAGGTVV
HINAGIAGLVGCILIGKRIGYGKELMAPHSLTMTLIGGALLWVGWFGFNAGSNLEANGTA
ALAMVNTFVATAAAAVAWLFVEWAVKGKPSMLGMVSGAVAGLVAVTPAAGFAGPMGCIIL
GFVSGTVCFVFCSTVKNALGYDDSLDVFGIHCIGGILGALATGILVNVDLGGAGIPDYSS
KPGELAVGAYEFGTAFMAQVKAVLFTLVFSGVGSLILFKIVDVIVGLRVAPDAEREGLDI
AEHGERAYHA