Protein Info for ABIE41_RS04685 in Bosea sp. OAE506

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF07992: Pyr_redox_2" amino acids 10 to 160 (151 residues), 29.1 bits, see alignment E=2.1e-10 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 10 to 619 (610 residues), 780.9 bits, see alignment E=4e-239 PF01134: GIDA" amino acids 11 to 399 (389 residues), 541.5 bits, see alignment E=3.9e-166 PF12831: FAD_oxidored" amino acids 11 to 147 (137 residues), 32.7 bits, see alignment E=1.6e-11 PF21680: GIDA_C_1st" amino acids 463 to 553 (91 residues), 49.1 bits, see alignment E=2.4e-16 PF13932: GIDA_C" amino acids 559 to 613 (55 residues), 61.7 bits, see alignment 1.4e-20

Best Hits

Swiss-Prot: 69% identical to MNMG_METPB: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 69% identity to mpo:Mpop_1656)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>ABIE41_RS04685 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG (Bosea sp. OAE506)
MSHNRSESRYDVVVVGGGHAGVEAAAAAARCGAQTALITHRLDTIGVMSCNPAIGGLGKG
HLVREIDALDGLMARAADRGGIQFRMLNRRKGPAVRGPRAQADRKLYREAIQDLLAHQDG
LTQIAGDVFDLDIRDGRVAGVILGDGRRFGAGTVVLTTGTFLRGLIHIGETRIPAGRVDE
APSLGLSATLDRHGFPLGRLKTGTPPRLDGRTIDWAALEMQAGDDPPEPFSALTDAITTP
QIACGITRTTLASHDLIRANLHRAPMFSGQIEGRGPRYCPSIEDKVGRFGDRDGHQIFLE
PEGLDDDTVYPNGISTSLPEDVQRGLLETIPGLERATMLRPGYAIEYDFVDPRSLRNTLE
TRAIAGLFLAGQINGTTGYEEAGAQGLLAGLNAACRAGGAEPVVLERMASYIGVMVDDLV
TRGVTEPYRMFTSRAEFRLSLRVDNADERLTALGAGLGVVGSRRMAAYESQNAETVALTE
RLRALTLSPQQAEAAGLQVNRDGIRRSAYQILSYPDAAFDSLAAVWPDLAGFSGRTIARV
TADAVYSVYLDRQADEIAAYQRDQALKVPDDLDLDAISGLSNELKAKLRAERPADIAQAG
RLEGMTPAALTLLAAHARKRRVLATVG