Protein Info for ABIE41_RS04665 in Bosea sp. OAE506

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 10 to 345 (336 residues), 372.4 bits, E=1.1e-115
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 11 to 345 (335 residues), 390.1 bits, E=4e-121

Best Hits

Swiss-Prot: 61% identical to DCUP_BRASO: Uroporphyrinogen decarboxylase (hemE) from Bradyrhizobium sp. (strain ORS 278)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 61% identity to bra:BRADO1875)

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (8/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (8/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (7/9 steps found)
• superpathway of heme b biosynthesis from glycine (6/8 steps found)
• heme b biosynthesis I (aerobic) (3/4 steps found)
• heme b biosynthesis II (oxygen-independent) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
• superpathway of heme b biosynthesis from glutamate (6/10 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (15/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Protein Sequence (346 amino acids)

>ABIE41_RS04665 uroporphyrinogen decarboxylase (Bosea sp. OAE506)
MSLTTPDQPAFLKALSGETLPTPPIWMMRQAGRYLPEYRELRAKAGSFLGLCYNPEWAAE
VTLQPIRRFGFDAAILFSDILVVPQALGQKLWFVEGEGPRLEPVADRDRLSEIDRQAGLS
VLDPVIETVRRVRASLPKETAFIGFCGAPWTVATYMVAGRGTPDQGPAKELFTRDEALFR
LMIDRIVVTSIDYLCAQIEAGVDAVQIFDSWAGSLGEADFERWCIVPTRRIVEGVRARQP
QAKIIGFPRGAGKLIPAYVRGTGVDAVGLESEIDRGFARDEIQSLVPVQGNLDPLVLRAG
GPELEREIAAVMEAFGKGPFVFNLGHGILPDTPIAHVERLLAAVRG