Protein Info for ABIE41_RS04555 in Bosea sp. OAE506

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 945 PF08364: IF2_assoc" amino acids 17 to 50 (34 residues), 44.7 bits, see alignment (E = 3.6e-15) TIGR00487: translation initiation factor IF-2" amino acids 357 to 945 (589 residues), 779.4 bits, see alignment E=2.7e-238 PF04760: IF2_N" amino acids 363 to 414 (52 residues), 45.3 bits, see alignment 1.7e-15 TIGR00231: small GTP-binding protein domain" amino acids 441 to 598 (158 residues), 113.9 bits, see alignment E=6.7e-37 PF01926: MMR_HSR1" amino acids 444 to 550 (107 residues), 40.1 bits, see alignment E=1.1e-13 PF00009: GTP_EFTU" amino acids 444 to 600 (157 residues), 116 bits, see alignment E=4.8e-37 PF11987: IF-2" amino acids 726 to 835 (110 residues), 136.2 bits, see alignment E=1.5e-43 PF03144: GTP_EFTU_D2" amino acids 866 to 933 (68 residues), 39.7 bits, see alignment 1.6e-13

Best Hits

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (945 amino acids)

>ABIE41_RS04555 translation initiation factor IF-2 (Bosea sp. OAE506)
MSDTKTPGDKTLTVSPPKTLSLKRPVEQSTVRQSFSHGRSKQVVVEVKRRVAGPDVKEVA
APRPAAPPVQQAAPRPAPAAPTPPARPASGMLLRTLSEDEKEARQRALSDSRGREAEARR
IAEDEARARALAAERERQEREAALARQREEEERRRQEEDRKRRAESAARQRMDEPQAPRA
PQPPRDVAPAAPSQPQSAPPPAAGFAPRPAAAGPRPEFAPRTPMRDVGARPPRLDSRPPR
LETPRPPRVDAAAPAEPAITRPTRQAPSTATPRSRPDDGEARPAFRRPGGGAGGPPRGAP
APAPKTPKVGEKPRGRLTLSTATGGDDERTRSVAAFRRRVQRMTGHRASDVAKERVMREV
IIPETITIQELANRMTERGVDVIRLLMKQGAMHKITDVIDADTAQLVAEEMGHTVKRVAE
SDVEEGLFDTPDTDETLLSRPAVVTIMGHVDHGKTSLLDAIRQTHVVTGEAGGITQHIGA
YQVKTPSGAFVTFIDTPGHAAFTAMRARGAKVTDVVVLVVAADDGVMPQTVEAINHAKAA
GVPLIVAINKIDKTDASPERVRAELLQYEIQVETLGGETLEIEVSAKTGKNLDKLLEAIA
LQAELLDLKANPDRPAEGTVIEAKLDRGRGPVATVLVQRGTLRTGDIVVAGSEWGRVRAL
IGDTGAQIKEAPPSLPVEVLGFNGTPEAGDRVAVVESEARAREITDYRERQKRDRIAARG
GGSSAGRSLADMMRDLKEGAGRKEFPLVVKGDVQGSVEAIVGTLEKVGNDEVRARVLQSG
VGGITESDITLAQASGAAVIGFNVRAHKEAREAAERAGVEIRYYNIIYNLVDDVKAAMSG
LLAPTLRETMLGNAQILEIFAVSKVGKIAGCRVTDGTIERGANVRLIRDNVVVHEGKLAQ
LKRFKDDAKEVVAGQECGMSFENYQDMRAGDVIECYRVEEIKRTL