Protein Info for ABIE41_RS04495 in Bosea sp. OAE506

Annotation: tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 3 to 441 (439 residues), 473.7 bits, see alignment E=6.1e-146 PF00919: UPF0004" amino acids 3 to 106 (104 residues), 103.2 bits, see alignment E=9.9e-34 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 3 to 441 (439 residues), 476.2 bits, see alignment E=9.2e-147 PF04055: Radical_SAM" amino acids 157 to 329 (173 residues), 92.8 bits, see alignment E=4.3e-30 PF01938: TRAM" amino acids 384 to 442 (59 residues), 34.9 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 70% identical to MIAB_METS4: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 70% identity to mno:Mnod_0235)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ABIE41_RS04495 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB (Bosea sp. OAE506)
MKKVHIKSFGCQMNVYDGQRMADILGEQGFEETATPEGADLILLNTCHIRDRAVQKVYTE
LGKLRDIKTAQKAEGQDTRIIVAGCVAQAEGAEIQRRQPAVDLVVGPQAYHRLPELLERA
RARRVVDTDLPIDDKFGHLPAPRPQTIRQRGISAFVTVQEGCDKFCAFCVVPYTRGAEFS
RPVAQVMAEIERLAASGVQDVTLIGQNVNAYHGEGPYGRVWGLARLMHRVAEVPGIARIR
YTTSHPRDMDDDLIAAHRDLPQVMPFLHLPVQAGSDRILAAMNRKHSAEDYRRLVDRIRQ
ARPDIALSSDFIVGFPGETDADFEATLALVDEIGFASSYSFKYSPRPGTPAADLDDAVPA
VVMDERLQRLQARIEHHRQAFNHAMVGRTVEVLLERAGRHPGQLAGKSPYLQAVQIETET
NQIGELVQVVIERAGSNSLFGRKAEAAGAGTGKPSSEDIAA