Protein Info for ABIE41_RS04360 in Bosea sp. OAE506

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00497: SBP_bac_3
  • amino acids 39 to 169 (131 residues), 53.9 bits, E=8e-19

Best Hits

Swiss-Prot: 50% identical to AAPJ_RHIL3: General L-amino acid-binding periplasmic protein AapJ (aapJ) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K09969, general L-amino acid transport system substrate-binding protein (inferred from 52% identity to sno:Snov_1397)

Predicted SEED Role

"Glutamate Aspartate periplasmic binding protein precursor GltI (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Protein Sequence (343 amino acids)

>ABIE41_RS04360 amino acid ABC transporter substrate-binding protein (Bosea sp. OAE506)
MMKTVLAATAALAASASLASAQQLAPSPTLDAIKARGHIECGVHLGLPGFSFADDKGEWT
GLDVDYCKALAAAVLGDAKKVKFTPTSVQQRWPILQSGQVDLLSRNSTITFSRNASLGLN
FQGINFYEGQTFIVRKATNAKSAADLDGASVCVAAGSTEEKNASDWFLERNLKVTITNFQ
KNDDAIAAYDAGRCDAYTAGVGALAGQRVKLKVPGDHIILTQPISNDPQGPVTRWGDERW
QLIVRWVLNGTIAAEMLGVTSANVDQMKSSSKNSEVRRLLGAEGNFGAMMGLSNDWMYNV
IKQVGNYGESFERTVGMGSTLKLERGQNQLWTKGGLLFTPPFQ