Protein Info for ABIE41_RS04265 in Bosea sp. OAE506

Annotation: phosphoribosylanthranilate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00697: PRAI" amino acids 10 to 212 (203 residues), 142.6 bits, see alignment E=6.2e-46

Best Hits

Swiss-Prot: 59% identical to TRPF_OLICO: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 61% identity to sno:Snov_3926)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABIE41_RS04265 phosphoribosylanthranilate isomerase (Bosea sp. OAE506)
MSASAQPLTIKICGLSTPETLEAALAAGAEMIGLVFHPKSPRFVPPEEAATLAAMARGRA
EIVALVVDREIGELTDLVAAVRPDWLQLHGRETPETVRAVKAATGLRAIKALGVADRHDL
AAFAAYEGVADRILLDAKPPKDAAYPGGHGRAFDWSILAALDRTSPFMLSGGLDPANVAQ
AIAIARPRGVDVSSGVERAPGVKDVDRITDFVVAARAAAATATEAGRT