Protein Info for ABIE41_RS04265 in Bosea sp. OAE506
Annotation: phosphoribosylanthranilate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to TRPF_OLICO: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 61% identity to sno:Snov_3926)Predicted SEED Role
"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (17/18 steps found)
- superpathway of L-tryptophan biosynthesis (12/13 steps found)
- L-tryptophan biosynthesis (6/6 steps found)
- superpathway of chorismate metabolism (35/59 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.1.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (228 amino acids)
>ABIE41_RS04265 phosphoribosylanthranilate isomerase (Bosea sp. OAE506) MSASAQPLTIKICGLSTPETLEAALAAGAEMIGLVFHPKSPRFVPPEEAATLAAMARGRA EIVALVVDREIGELTDLVAAVRPDWLQLHGRETPETVRAVKAATGLRAIKALGVADRHDL AAFAAYEGVADRILLDAKPPKDAAYPGGHGRAFDWSILAALDRTSPFMLSGGLDPANVAQ AIAIARPRGVDVSSGVERAPGVKDVDRITDFVVAARAAAATATEAGRT